PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.198560.1
Common NameCsa_1G015610, LOC101212701
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 325aa    MW: 35137.8 Da    PI: 8.3003
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.198560.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1245e-393394263
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                    +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+sss
  Cucsa.198560.1 33 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRSSS 94
                    57899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-263487IPR003851Zinc finger, Dof-type
PfamPF027012.9E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6183791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MQDIHSIAGG SRLFGGGGGG DRRLRPHLHH HQNHQALKCP RCDSLNTKFC YYNNYNLSQP  60
RHFCKSCRRY WTKGGVLRNV PVGGGCRKTK RSSSSKSKSN SSDAVATPPP LPPPPLPLPL  120
RDRKSTSHSS SESSSLTATT TTAAAAAAAA ATEAVSAPSS NSASGLLNVH DTKLFTGSST  180
TNTNPNFEVP DCGIFSEIGS FTSLITSSNE TLAFGFGNMA DVTAFAMNNH HQFQNQTANQ  240
WPPPPPPSQR MMNVNDELKM QGGYMDQTAQ VDPNSRSNNI GFGALDWQSN GDHQVLFDLP  300
TAVDQAYWSQ NQWNDQDQPN LYLP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011648588.11e-168PREDICTED: dof zinc finger protein DOF5.4
TrEMBLA0A0A0LSJ31e-168A0A0A0LSJ3_CUCSA; Uncharacterized protein
STRINGPOPTR_0012s12670.16e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.14e-34OBF binding protein 4
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]